Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sheep Melanocortin receptor 5 (MC5R)

This Recombinant Sheep Melanocortin receptor 5 (MC5R) spans the amino acid sequence from region 1-325.

Product Specifications

Product Name Alternative

Melanocortin receptor 5, MC5-R

UniProt

P41983

Expression Region

1-325

Origin

Ovis aries (Sheep)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNSSFHLHFLDLGLNATEGNLSGLSVRNASSPCEDMGIAVEVFLALGLISLLENILVIGA IVRNRNLHIPMYFFVGSLAVADMLVSLSNFWETITIYLLTNKHLVMADASVRHLDNVFDS MICISVVASMCSLLAIAVDRYVTIFCRLRYQRIMTGRRSGAIIAGIWAFCTSCGTVFIVY YESTYVVVCLIAMFLTMLLLMASLYTHMFLLARTHVRRIAALPGHSSVRQRTGVKGAITL AMLLGVFIICWAPFFLHLILMISCPQNLYCSCFMSHFNMYLILIMCNSVIDPLIYAFRSQ EMRKTFKEIVCFQGFRTPCRFPSTY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BCL3 Antibody
orb523167-01 50 μL

BCL3 Antibody

Sign In for Pricing
View Details
BCL3 Antibody
orb523167-02 100 µL

BCL3 Antibody

Sign In for Pricing
View Details
Rno-miR-6327 agomir
HY-R04539A-01 5 nmol

Rno-miR-6327 agomir

Sign In for Pricing
View Details
Rno-miR-6327 agomir
HY-R04539A-02 20 nmol

Rno-miR-6327 agomir

Sign In for Pricing
View Details
PCTAIRE-2 Lentiviral Activation Particles (h2)
sc-406469-LAC-2 200 µL

PCTAIRE-2 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
Human TBX21 Knockout HEK293T cell line
GTR15414996 1 Vial

Human TBX21 Knockout HEK293T cell line

Sign In for Pricing
View Details