Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Vomeronasal type-1 receptor A12 (V1ra12)

This Recombinant Rat Vomeronasal type-1 receptor A12 (V1ra12) spans the amino acid sequence from region 1-326.

Product Specifications

Product Name Alternative

Vomeronasal type-1 receptor A12, Pheromone receptor VN3, Vomeronasal receptor 3

UniProt

Q5J3L6

Expression Region

1-326

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEFPFFSPQPLFSYMMNKNSRVHTDSNIRNTFFTEIGIGILANSFLLLFHIFKFIRGQR SRLTDLPIGLLSLIHLLMLLMGAFIAIDIFISWRGWDDIICKFLVYLYRSFRGLSLCTTC MLSVLQAITLSPRSSCLAKFKHKSPHHVSCAIISLSILYMFISSHLLVSINATPNLTTNN FMQVTQSCYIIPLSYLMQSMFSTLLAIRDISLISLMVLSTCYMVVLLCRHRNQIQHLQGT NLSPKASPEQRATQTILMLMTFFVLMSIFDSIVSCSRTMYLNDPTSYYIQIFVVYIYATV SPFVFMSTEKHIVNFLKSMCVRVKNV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC18 / Mucin 18 / CD146 (OJ79c), CF740 conjugate, 0.1mg/mL
BNC740676-500 1x 500 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF647 conjugate, 0.1mg/mL
BNC470034-100 1x 100 µL

Cytokeratin 8/18 (C-51), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF594 conjugate, 0.1mg/mL
BNC940176-500 1x 500 µL

CD5 (Cris-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Heparan Sulphate Proteoglycan (A7L6), CF568 conjugate, 0.1mg/mL
BNC680315-500 1x 500 µL

Heparan Sulphate Proteoglycan (A7L6), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BARX1 (Prognostic Biomarker in Hepatocellular Carcinoma) (BARX1/2759), CF568 conjugate, 0.1mg/mL
BNC682759-500 1x 500 µL

BARX1 (Prognostic Biomarker in Hepatocellular Carcinoma) (BARX1/2759), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-2 (Apoptosis & Follicular Lymphoma Marker) (BCL2/2210R), CF488A conjugate, 0.1mg/mL
BNC882210-500 1x 500 µL

Bcl-2 (Apoptosis & Follicular Lymphoma Marker) (BCL2/2210R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details