Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii Adenosine receptor A1 (ADORA1)

This Recombinant Pongo abelii Adenosine receptor A1 (ADORA1) spans the amino acid sequence from region 1-326.

Product Specifications

Product Name Alternative

Adenosine receptor A1

UniProt

Q5RF57

Expression Region

1-326

Origin

Pongo abelii (Sumatran orangutan)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVLLAVADVAVGA LVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLTIAVDRYLRVKIPLRYKMVVT PRRAAVAIAGCWILSFVVGLTPMFGWNNLSAVERAWAANGSMGEPVIKCEFEKVISMEYM VYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALIL FLFALSWLPLHILNCITLFCPSCHKPSILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFL KIWNDNFRCQPAPPIDEDLPEERPDD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dispensing Peristaltic Pump
51-DPP101 1 Unit

Dispensing Peristaltic Pump

Sign In for Pricing
View Details
CHRNA1 antibody
70R-13799 0.1 mg

CHRNA1 antibody

Sign In for Pricing
View Details
Mouse Copine I (CPNE1) ELISA Kit
QY-E20380 96 Tests

Mouse Copine I (CPNE1) ELISA Kit

Sign In for Pricing
View Details
Microseminoprotein Beta (MSMb) BioAssayTM ELISA Kit (Human)
026814 96 Tests

Microseminoprotein Beta (MSMb) BioAssayTM ELISA Kit (Human)

Sign In for Pricing
View Details
Bag6 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3292503 1.0 µg DNA

Bag6 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Anti-Purple sea urchin P63 Antibody, Carrier-free
DZ41453-carrier-free 200 µL/Vial

Anti-Purple sea urchin P63 Antibody, Carrier-free

Sign In for Pricing
View Details