Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii Adenosine receptor A1 (ADORA1)

This Recombinant Pongo abelii Adenosine receptor A1 (ADORA1) spans the amino acid sequence from region 1-326.

Product Specifications

Product Name Alternative

Adenosine receptor A1

UniProt

Q5RF57

Expression Region

1-326

Origin

Pongo abelii (Sumatran orangutan)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVLLAVADVAVGA LVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLTIAVDRYLRVKIPLRYKMVVT PRRAAVAIAGCWILSFVVGLTPMFGWNNLSAVERAWAANGSMGEPVIKCEFEKVISMEYM VYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALIL FLFALSWLPLHILNCITLFCPSCHKPSILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFL KIWNDNFRCQPAPPIDEDLPEERPDD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD9 Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb1577724 100 µL

CD9 Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
Goat Calcitonin ELISA Kit
MBS738995-01 48 Well

Goat Calcitonin ELISA Kit

Sign In for Pricing
View Details
Goat Calcitonin ELISA Kit
MBS738995-02 96 Well

Goat Calcitonin ELISA Kit

Sign In for Pricing
View Details
Goat Calcitonin ELISA Kit
MBS738995-03 5x 96 Well

Goat Calcitonin ELISA Kit

Sign In for Pricing
View Details
Goat Calcitonin ELISA Kit
MBS738995-04 10x 96 Well

Goat Calcitonin ELISA Kit

Sign In for Pricing
View Details
Cyclophilin A (PPIA) (NM_021130) Human Tagged ORF Clone Lentiviral Particle
RC203307L2V 200 µL

Cyclophilin A (PPIA) (NM_021130) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details