Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chlorobium tepidum ATP synthase subunit a 2 (atpB2)

This Recombinant Chlorobium tepidum ATP synthase subunit a 2 (atpB2) spans the amino acid sequence from region 27-352.

Product Specifications

Product Name Alternative

ATP synthase subunit a 2, ATP synthase F0 sector subunit a 2, F-ATPase subunit 6 2

UniProt

Q8KGE7

Expression Region

27-352

Origin

Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / TLS)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

TSVQDESPVTGSAVEAVHTVPSTVAAPVAGHAEAAAGQAAKAEEKPGDLIMHHILDNSTF SFEPFGEVHLPHLEVAGFDISITKHVVMIWLAAILLVVIASAAGASVKKMSANQAPKGVA NVFESLVDFISNDVAKPNIGHGYEKFLPYLLTVFFFILVCNLLGLIPYGATATGNINVTL TLSVFTFVITQFSAFKAQGVKGYLQHLTAGTHWALWIIMVPIEILGQFTKPFALTIRLFA NMTAGHIIILSLFFISFILKSYIVAVAVSIPFAIFIYLLELFVAFLQAYVFTMLSALFIG LATAHSDSHDGHELEATARHGDGLTV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cdh15 Mouse Gene Knockout Kit (CRISPR)
KN503003 1 Kit

Cdh15 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PLAT Rabbit Monoclonal Antibody
TA422894 100 µL

PLAT Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
TUBGCP2 Rabbit Polyclonal Antibody
TA371356 100 µL

TUBGCP2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Histone H1 (Nuclear Marker) (HH1/1784R), CF647 conjugate, 0.1mg/mL
BNC471784-500 1x 500 µL

Histone H1 (Nuclear Marker) (HH1/1784R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Activin Receptor Type IA (ACVR1) (NM_001111067) Human Over-expression Lysate
LC426349 20 µg

Activin Receptor Type IA (ACVR1) (NM_001111067) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Gfer activation kit by CRISPRa
GA200172 1 Kit

Mouse Gfer activation kit by CRISPRa

Sign In for Pricing
View Details