Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chlorobium tepidum ATP synthase subunit a 2 (atpB2)

This Recombinant Chlorobium tepidum ATP synthase subunit a 2 (atpB2) spans the amino acid sequence from region 27-352.

Product Specifications

Product Name Alternative

ATP synthase subunit a 2, ATP synthase F0 sector subunit a 2, F-ATPase subunit 6 2

UniProt

Q8KGE7

Expression Region

27-352

Origin

Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / TLS)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

TSVQDESPVTGSAVEAVHTVPSTVAAPVAGHAEAAAGQAAKAEEKPGDLIMHHILDNSTF SFEPFGEVHLPHLEVAGFDISITKHVVMIWLAAILLVVIASAAGASVKKMSANQAPKGVA NVFESLVDFISNDVAKPNIGHGYEKFLPYLLTVFFFILVCNLLGLIPYGATATGNINVTL TLSVFTFVITQFSAFKAQGVKGYLQHLTAGTHWALWIIMVPIEILGQFTKPFALTIRLFA NMTAGHIIILSLFFISFILKSYIVAVAVSIPFAIFIYLLELFVAFLQAYVFTMLSALFIG LATAHSDSHDGHELEATARHGDGLTV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PF 670462
TRC-P293960-5MG 5 mg

PF 670462

Sign In for Pricing
View Details
p73 (TP73) Human Knockdown Lysate
LY300452 100 µg

p73 (TP73) Human Knockdown Lysate

Sign In for Pricing
View Details
GFAP (GA-5 + ASTRO/789), 0.2mg/mL
BNUB0898-500 1x 500 µL

GFAP (GA-5 + ASTRO/789), 0.2mg/mL

Sign In for Pricing
View Details
Aldoa Mouse Gene Knockout Kit (CRISPR)
KN501129 1 Kit

Aldoa Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Nkx3.1 (NKX3-1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7F6]
TA805166BM 100 µL

Nkx3.1 (NKX3-1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7F6]

Sign In for Pricing
View Details
Uncoated Rat βTG/PBP/CXCL7/NAP2 (Thromboglobulin, Beta) ELISA Kit
E-UNEL-R0037-01 5x 96 Tests

Uncoated Rat βTG/PBP/CXCL7/NAP2 (Thromboglobulin, Beta) ELISA Kit

Sign In for Pricing
View Details