Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 4C5 (OR4C5)

This Recombinant Human Olfactory receptor 4C5 (OR4C5) spans the amino acid sequence from region 1-326.

Product Specifications

Product Name Alternative

Olfactory receptor 4C5, Olfactory receptor OR11-99

UniProt

Q8NGB2

Expression Region

1-326

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYVSNCNPCAIHRKINYPNTKLDFEQVNNITEFILLGLTQNAEAQKLLFAVFTLIYFLTM VDNLIIVVTITTSPALDSPVYFFLSFFSFIDGCSSSTMAPKMIFDLLTEKKTISFSGCMT QLFVEHFFGGVEIILLVVMAYDCYVAICKPLYYLITMNRQVCGLLVAMAWVGGFLHALIQ MLLIVWLPFCGPNVIDHFICDLFPLLKLSCTDTHVFGLFVAANSGLMCMLIFSILITSYV LILCSQRKALSTCAFHITVVVLFFVPCILVYLRPMITFPIDKAVSVFYTVVTPMLNPLIY TLRNTEVKNAMKQLWSQIIWGNNLCD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD74 (LN-2)
sc-6262 200 µg/mL

CD74 (LN-2)

Sign In for Pricing
View Details
DDX24 antibody
70R-36291 100 ug

DDX24 antibody

Sign In for Pricing
View Details
PH1-JUN-shRNA1 Plasmid
PVT83999 2 µg

PH1-JUN-shRNA1 Plasmid

Sign In for Pricing
View Details
Mouse Monoclonal Thymidine Kinase 1 Antibody (2A2)
H00007083-M11 0.1 mg

Mouse Monoclonal Thymidine Kinase 1 Antibody (2A2)

Sign In for Pricing
View Details
CREB3L2 Knockout NCI-H1299 Polyclonal Cells
ARG17531 1 Million

CREB3L2 Knockout NCI-H1299 Polyclonal Cells

Sign In for Pricing
View Details
DMAP1 Protein Lysate (Human) with C-Ha Tag
18304031 100 µg

DMAP1 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details