Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 4C5 (OR4C5)

This Recombinant Human Olfactory receptor 4C5 (OR4C5) spans the amino acid sequence from region 1-326.

Product Specifications

Product Name Alternative

Olfactory receptor 4C5, Olfactory receptor OR11-99

UniProt

Q8NGB2

Expression Region

1-326

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYVSNCNPCAIHRKINYPNTKLDFEQVNNITEFILLGLTQNAEAQKLLFAVFTLIYFLTM VDNLIIVVTITTSPALDSPVYFFLSFFSFIDGCSSSTMAPKMIFDLLTEKKTISFSGCMT QLFVEHFFGGVEIILLVVMAYDCYVAICKPLYYLITMNRQVCGLLVAMAWVGGFLHALIQ MLLIVWLPFCGPNVIDHFICDLFPLLKLSCTDTHVFGLFVAANSGLMCMLIFSILITSYV LILCSQRKALSTCAFHITVVVLFFVPCILVYLRPMITFPIDKAVSVFYTVVTPMLNPLIY TLRNTEVKNAMKQLWSQIIWGNNLCD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aryl hydrocarbon Receptor/AHR Rabbit Polyclonal Antibody (Fluoro488)
orb3077499 100 µg

Aryl hydrocarbon Receptor/AHR Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
MNAT1 Polyclonal Antibody, RBITC Conjugated
bs-7896R-RBITC 100 µL

MNAT1 Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details
ADAM7 Antibody
A56983-50UL 50 μL

ADAM7 Antibody

Sign In for Pricing
View Details
DFFB Antibody (N-term)
E45R07567G-1 100 µL

DFFB Antibody (N-term)

Sign In for Pricing
View Details
PDGF-C Polyclonal Antibody
46833-01 50 µL

PDGF-C Polyclonal Antibody

Sign In for Pricing
View Details
PDGF-C Polyclonal Antibody
46833-02 100 µL

PDGF-C Polyclonal Antibody

Sign In for Pricing
View Details