Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 8A1 (OR8A1)

This Recombinant Human Olfactory receptor 8A1 (OR8A1) spans the amino acid sequence from region 1-326.

Product Specifications

Product Name Alternative

Olfactory receptor 8A1, OST025, Olfactory receptor OR11-318

UniProt

Q8NGG7

Expression Region

1-326

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGFLSPMHPCRPPTQRRMAAGNHSTVTEFILKGLTKRADLQLPLFLLFLGIYLVTIVGNL GMITLICLNSQLHTPMYYFLSNLSLMDLCYSSVITPKMLVNFVSEKNIISYAGCMSQLYF FLVFVIAECYMLTVMAYDRYVAICHPLLYNIIMSHHTCLLLVAVVYAIGLIGSTIETGLM LKLPYCEHLISHYFCDILPLMKLSCSSTYDVEMTVFFSAGFNIIVTSLTVLVSYTFILSS ILGISTTEGRSKAFSTCSSHLAAVGMFYGSTAFMYLKPSTISSLTQENVASVFYTTVIPM LNPLIYSLRNKEVKAAVQKTLRGKLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

YWHAQP3 Protein Vector (Human) (pPM-C-His)
PV144125 500 ng

YWHAQP3 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Integrin beta3 Peptide
AF6085-BP 1 mg

Integrin beta3 Peptide

Sign In for Pricing
View Details
Phospho-IL2 Receptor beta (Tyr364) Rabbit Polyclonal Antibody (BF555)
orb2545714 100 µL

Phospho-IL2 Receptor beta (Tyr364) Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details
Isoescin IB
M21793-01 1 g

Isoescin IB

Sign In for Pricing
View Details
Isoescin IB
M21793-02 200 mg

Isoescin IB

Sign In for Pricing
View Details
Isoescin IB
M21793-03 500 mg

Isoescin IB

Sign In for Pricing
View Details