Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 11H1 (OR11H1)

This Recombinant Human Olfactory receptor 11H1 (OR11H1) spans the amino acid sequence from region 1-326.

Product Specifications

Product Name Alternative

Olfactory receptor 11H1, Olfactory receptor OR22-1

UniProt

Q8NG94

Expression Region

1-326

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MCPLTLQVTGLMNVSEPNSSFAFVNEFILQGFSCEWTIQIFLFSLFTTTYALTITGNGAI AFVLWCDRRLHTPMYMFLGNFSFLEIWYVSSTVPKMLVNFLSEKKNISFAGCFLQFYFFF SLGTSECLLLTVMAFDQYLAICRPLLYPNIMTGHLYAKLVILCWVCGFLWFLIPIVLISQ MPFCGPNIIDHVVCDPGPRFALDCVSAPRIQLFCYTLSSLVIFGNFLFIIGSYTLVLKAM LGMPSSTGRHKAFSTCGSHLAVVSLCYSSLMVMYVSPGLGHSTGMQKIETLFYAMVTPLF NPLIYSLQNKEIKAALRKVLGSSNII

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZBTB43 (NM_001135776) Human Over-expression Lysate
LC427708 20 µg

ZBTB43 (NM_001135776) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human PAI-2 protein (His tag)
PDEH100919-01 20 µg

Recombinant Human PAI-2 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human PAI-2 protein (His tag)
PDEH100919-02 100 µg

Recombinant Human PAI-2 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human PAI-2 protein (His tag)
PDEH100919-03 500 µg

Recombinant Human PAI-2 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human PAI-2 protein (His tag)
PDEH100919-04 1 mg

Recombinant Human PAI-2 protein (His tag)

Sign In for Pricing
View Details
Biotin Anti-Human CD62L Antibody[DREG56]
E-AB-F1051B-01 25 µg

Biotin Anti-Human CD62L Antibody[DREG56]

Sign In for Pricing
View Details