Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human JNK1/MAPK8-associated membrane protein (JKAMP)

This Recombinant Human JNK1/MAPK8-associated membrane protein (JKAMP) spans the amino acid sequence from region 1-326.

Product Specifications

Product Name Alternative

JNK1/MAPK8-associated membrane protein, JKAMP, JNK1-associated membrane protein, JAMP, Medulloblastoma antigen MU-MB-50.4

UniProt

Q9P055

Expression Region

1-326

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFGAAARSADLALLEKNLQAAHGCLGLYCGKTLLFKNGSTEIYGECGVCPRGQRTNAQKY CQPCTESPELYDWLYLGFMAMLPLVLHWFFIEWYSGKKSSSALFQHITALFECSMAAIIT LLVSDPVGVLYIRSCRVLMLSDWYTMLYNPSPDYVTTVHCTHEAVYPLYTIVFIYYAFCL VLMMLLRPLLVKKIACGLGKSDRFKSIYAALYFFPILTVLQAVGGGLLYYAFPYIILVLS LVTLAVYMSASEIENCYDLLVRKKRLIVLFSHWLLHAYGIISISRVDKLEQDLPLLALVP TPALFYLFTAKFTEPSRILSEGANGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bisphenol F Mono-Beta-D-glucuronide
TRC-B519598-2.5MG 2.5 mg

Bisphenol F Mono-Beta-D-glucuronide

Sign In for Pricing
View Details
IFNA17 (NM_021268) Human Recombinant Protein
TP320824L 1 mg

IFNA17 (NM_021268) Human Recombinant Protein

Sign In for Pricing
View Details
ZSCAN4 Human Gene Knockout Kit (CRISPR)
KN211003BN 1 Kit

ZSCAN4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human CGNL1 activation kit by CRISPRa
GA113795 1 Kit

Human CGNL1 activation kit by CRISPRa

Sign In for Pricing
View Details
SMAGP (NM_001033873) Human Over-expression Lysate
LC422425 20 µg

SMAGP (NM_001033873) Human Over-expression Lysate

Sign In for Pricing
View Details
Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2103R), CF488A conjugate, 0.1mg/mL
BNC882103-500 1x 500 µL

Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2103R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details