Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human JNK1/MAPK8-associated membrane protein (JKAMP)

This Recombinant Human JNK1/MAPK8-associated membrane protein (JKAMP) spans the amino acid sequence from region 1-326.

Product Specifications

Product Name Alternative

JNK1/MAPK8-associated membrane protein, JKAMP, JNK1-associated membrane protein, JAMP, Medulloblastoma antigen MU-MB-50.4

UniProt

Q9P055

Expression Region

1-326

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFGAAARSADLALLEKNLQAAHGCLGLYCGKTLLFKNGSTEIYGECGVCPRGQRTNAQKY CQPCTESPELYDWLYLGFMAMLPLVLHWFFIEWYSGKKSSSALFQHITALFECSMAAIIT LLVSDPVGVLYIRSCRVLMLSDWYTMLYNPSPDYVTTVHCTHEAVYPLYTIVFIYYAFCL VLMMLLRPLLVKKIACGLGKSDRFKSIYAALYFFPILTVLQAVGGGLLYYAFPYIILVLS LVTLAVYMSASEIENCYDLLVRKKRLIVLFSHWLLHAYGIISISRVDKLEQDLPLLALVP TPALFYLFTAKFTEPSRILSEGANGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

uronyl 2 suLfotransferase (UST) (NM_005715) Human Over-expression Lysate
LY401743 100 µg

uronyl 2 suLfotransferase (UST) (NM_005715) Human Over-expression Lysate

Sign In for Pricing
View Details
CXCL13 Rabbit polyclonal Antibody
ER65489 100 µL

CXCL13 Rabbit polyclonal Antibody

Sign In for Pricing
View Details
CUG BP1 (CELF1) (NM_006560) Human Over-expression Lysate
LC401964 20 µg

CUG BP1 (CELF1) (NM_006560) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant PRC1 (phospho T481) Antibody
RC-4760-01 50 μL

Recombinant PRC1 (phospho T481) Antibody

Sign In for Pricing
View Details
Recombinant PRC1 (phospho T481) Antibody
RC-4760-02 100 µL

Recombinant PRC1 (phospho T481) Antibody

Sign In for Pricing
View Details
Recombinant PRC1 (phospho T481) Antibody
RC-4760-03 1 mL

Recombinant PRC1 (phospho T481) Antibody

Sign In for Pricing
View Details