Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human JNK1/MAPK8-associated membrane protein (JKAMP)

This Recombinant Human JNK1/MAPK8-associated membrane protein (JKAMP) spans the amino acid sequence from region 1-326.

Product Specifications

Product Name Alternative

JNK1/MAPK8-associated membrane protein, JKAMP, JNK1-associated membrane protein, JAMP, Medulloblastoma antigen MU-MB-50.4

UniProt

Q9P055

Expression Region

1-326

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFGAAARSADLALLEKNLQAAHGCLGLYCGKTLLFKNGSTEIYGECGVCPRGQRTNAQKY CQPCTESPELYDWLYLGFMAMLPLVLHWFFIEWYSGKKSSSALFQHITALFECSMAAIIT LLVSDPVGVLYIRSCRVLMLSDWYTMLYNPSPDYVTTVHCTHEAVYPLYTIVFIYYAFCL VLMMLLRPLLVKKIACGLGKSDRFKSIYAALYFFPILTVLQAVGGGLLYYAFPYIILVLS LVTLAVYMSASEIENCYDLLVRKKRLIVLFSHWLLHAYGIISISRVDKLEQDLPLLALVP TPALFYLFTAKFTEPSRILSEGANGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLTRN antibody
FNab08777 100 µg

CLTRN antibody

Sign In for Pricing
View Details
Dextrorphan Tartrate Salt
TRC-D299485-500MG 500 mg

Dextrorphan Tartrate Salt

Sign In for Pricing
View Details
Recombinant Human LEPR/CD295 Protein (His Tag)
PKSH031688-01 100 µg

Recombinant Human LEPR/CD295 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human LEPR/CD295 Protein (His Tag)
PKSH031688-02 1 mg

Recombinant Human LEPR/CD295 Protein (His Tag)

Sign In for Pricing
View Details
Human OR51F2 activation kit by CRISPRa
GA114698 1 Kit

Human OR51F2 activation kit by CRISPRa

Sign In for Pricing
View Details
Topoisomerase I, Mitochondrial (TOP1MT) (TOP1MT/2883R), CF488A conjugate, 0.1mg/mL
BNC882883-100 1x 100 µL

Topoisomerase I, Mitochondrial (TOP1MT) (TOP1MT/2883R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details