Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Guinea pig Adenosine receptor A1 (ADORA1)

This Recombinant Guinea pig Adenosine receptor A1 (ADORA1) spans the amino acid sequence from region 1-326.

Product Specifications

Product Name Alternative

Adenosine receptor A1

UniProt

P47745

Expression Region

1-326

Origin

Cavia porcellus (Guinea pig)

Field of Research

Neuroscience; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPHSVSAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIASLAVADVAVGA LVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKTVVT PRRAAVAIAGCWILSLVVGLTPMFGWNNLSKIEMAWAANGSVGEPVIKCEFEKVISMEYM VYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLSKKVSASSGDPQKYYGKELKIAKSLALIL FLFALSWLPLHILNCITLFCPTCHKPTILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFL KIWNDHFRCQPEPPIDEDLPEEKVDD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/2338R), CF488A conjugate, 0.1mg/mL
BNC882338-500 1x 500 µL

Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/2338R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GATA-3 (Breast and Urothelial Marker) (GATA3/2445), CF640R conjugate, 0.1mg/mL
BNC402445-100 1x 100 µL

GATA-3 (Breast and Urothelial Marker) (GATA3/2445), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TIF1 alpha (TRIM24) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3A8]
TA802789AM 100 µL

TIF1 alpha (TRIM24) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3A8]

Sign In for Pricing
View Details
Prostate Specific Antigen (PSA) (KLK3/2871R), CF405S conjugate, 0.1mg/mL
BNC042871-100 1x 100 µL

Prostate Specific Antigen (PSA) (KLK3/2871R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
beta Actin (ACTB) Goat Polyclonal Antibody
AB0145-200 600 µg

beta Actin (ACTB) Goat Polyclonal Antibody

Sign In for Pricing
View Details
Bexagliflozin Ethylene-D4
TRC-B965621-25MG 25 mg

Bexagliflozin Ethylene-D4

Sign In for Pricing
View Details