Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Guinea pig Adenosine receptor A1 (ADORA1)

This Recombinant Guinea pig Adenosine receptor A1 (ADORA1) spans the amino acid sequence from region 1-326.

Product Specifications

Product Name Alternative

Adenosine receptor A1

UniProt

P47745

Expression Region

1-326

Origin

Cavia porcellus (Guinea pig)

Field of Research

Neuroscience; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPHSVSAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIASLAVADVAVGA LVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKTVVT PRRAAVAIAGCWILSLVVGLTPMFGWNNLSKIEMAWAANGSVGEPVIKCEFEKVISMEYM VYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLSKKVSASSGDPQKYYGKELKIAKSLALIL FLFALSWLPLHILNCITLFCPTCHKPTILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFL KIWNDHFRCQPEPPIDEDLPEEKVDD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C20orf141 Human qPCR Primer Pair (NM_080739)
HP216734 200 Reactions

C20orf141 Human qPCR Primer Pair (NM_080739)

Sign In for Pricing
View Details
Recombinant Mouse Pleiotrophin/PTN/HB-GAM Protein (Fc Tag)
PKSM040396 100 µg

Recombinant Mouse Pleiotrophin/PTN/HB-GAM Protein (Fc Tag)

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), Biotin conjugate, 0.1mg/mL
BNCB0225-100 1x 100 µL

Major Vault Protein (MVP) (1032), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Tumor Necrosis Factor Beta (TNFb) ELISA Kit
RD-TNFb-Mu-01 96 Tests

Mouse Tumor Necrosis Factor Beta (TNFb) ELISA Kit

Sign In for Pricing
View Details
Mouse Tumor Necrosis Factor Beta (TNFb) ELISA Kit
RD-TNFb-Mu-02 48 Tests

Mouse Tumor Necrosis Factor Beta (TNFb) ELISA Kit

Sign In for Pricing
View Details
CD79a (IGA/764), CF568 conjugate, 0.1mg/mL
BNC680764-500 1x 500 µL

CD79a (IGA/764), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details