Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Adenosine receptor A1 (Adora1)

This Recombinant Rat Adenosine receptor A1 (Adora1) spans the amino acid sequence from region 1-326.

Product Specifications

Product Name Alternative

Adenosine receptor A1

UniProt

P25099

Expression Region

1-326

Origin

Rattus norvegicus (Rat)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPPYISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA LVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKTVVT QRRAAVAIAGCWILSLVVGLTPMFGWNNLSVVEQDWRANGSVGEPVIKCEFEKVISMEYM VYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALIL FLFALSWLPLHILNCITLFCPTCQKPSILIYIAIFLTHGNSAMNPIVYAFRIHKFRVTFL KIWNDHFRCQPKPPIDEDLPEEKAED

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RRAGA Rabbit Polyclonal Antibody
HA500373 100 µL

RRAGA Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Hygromycin B Deuterated (d4 major)
TRC-H997604-2.5MG 2.5 mg

Hygromycin B Deuterated (d4 major)

Sign In for Pricing
View Details
CD63 (Late Endosomes Marker) (LAMP3/2990R), CF640R conjugate, 0.1mg/mL
BNC402990-100 1x 100 µL

CD63 (Late Endosomes Marker) (LAMP3/2990R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Rat IL-1 beta Recombinant Rabbit Monoclonal Antibody [PSH02-59] - BSA and Azide free (Capture)
HA721836 100 µL

Rat IL-1 beta Recombinant Rabbit Monoclonal Antibody [PSH02-59] - BSA and Azide free (Capture)

Sign In for Pricing
View Details
Mouse Transient Receptor Potential Cation Channel Subfamily V, Member 1 (TRPV1) ELISA Kit
RD-TRPV1-Mu-01 96 Tests

Mouse Transient Receptor Potential Cation Channel Subfamily V, Member 1 (TRPV1) ELISA Kit

Sign In for Pricing
View Details
Mouse Transient Receptor Potential Cation Channel Subfamily V, Member 1 (TRPV1) ELISA Kit
RD-TRPV1-Mu-02 48 Tests

Mouse Transient Receptor Potential Cation Channel Subfamily V, Member 1 (TRPV1) ELISA Kit

Sign In for Pricing
View Details