Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Adenosine receptor A1 (Adora1)

This Recombinant Rat Adenosine receptor A1 (Adora1) spans the amino acid sequence from region 1-326.

Product Specifications

Product Name Alternative

Adenosine receptor A1

UniProt

P25099

Expression Region

1-326

Origin

Rattus norvegicus (Rat)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPPYISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA LVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKTVVT QRRAAVAIAGCWILSLVVGLTPMFGWNNLSVVEQDWRANGSVGEPVIKCEFEKVISMEYM VYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALIL FLFALSWLPLHILNCITLFCPTCQKPSILIYIAIFLTHGNSAMNPIVYAFRIHKFRVTFL KIWNDHFRCQPKPPIDEDLPEEKAED

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lsm2 (BC049543) Mouse Tagged ORF Clone
MG200745 10 µg

Lsm2 (BC049543) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Human Interleukin 2 (IL2) ELISA Kit
RD-IL2-Hu-01 96 Tests

Human Interleukin 2 (IL2) ELISA Kit

Sign In for Pricing
View Details
Human Interleukin 2 (IL2) ELISA Kit
RD-IL2-Hu-02 48 Tests

Human Interleukin 2 (IL2) ELISA Kit

Sign In for Pricing
View Details
Colloidal Gold Conjugated Monoclonal Antibody to Hepatitis B Surface Antigen,  5nm
GM-47-5 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Hepatitis B Surface Antigen, 5nm

Sign In for Pricing
View Details
HCG-beta (HCGb/54), CF647 conjugate, 0.1mg/mL
BNC470054-100 1x 100 µL

HCG-beta (HCGb/54), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tmprss12 Mouse Gene Knockout Kit (CRISPR)
KN517937 1 Kit

Tmprss12 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details