Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class gamma-14 (srg-14)

This Recombinant Serpentine receptor class gamma-14 (srg-14) spans the amino acid sequence from region 1-326.

Product Specifications

Product Name Alternative

Serpentine receptor class gamma-14, Protein srg-14

UniProt

P91275

Expression Region

1-326

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSDFSPDMKNLDIDPIPVDCDLSYNTNIEVLKFTAQIIYIITGIFLNSAVLGTILWRCRE VYSTNSFFTLFSVDCIANISILITEGLFARFFIYFTPICPVLADYFQSPLVGFKIIMLLT HHVSICKSLLQVLLVLNRMTCVLFPITHDSIWRKSLKYVISAVFLIPFCADWNIAISRVY MQSTYGGFWVSYFKKVSWASQSRFQLVFIIIALSFTFICTAITLLKLPERSKEIEKAISN ATVIISIGFTFKVLFQIYYSFFFSYTDASSPVYGFSFLALDFLTVGSPIVMICVSRNLRT HIFKSKRKNQTLSKMLTRTSGMVIAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cathepsin D (Tumor Marker) (CTSD/3083), 0.2mg/mL
BNUB3083-100 1x 100 µL

Cathepsin D (Tumor Marker) (CTSD/3083), 0.2mg/mL

Sign In for Pricing
View Details
Germacrone (>90%)
TRC-G367755-10MG 10 mg

Germacrone (>90%)

Sign In for Pricing
View Details
Tissue FFPE Sections, Smooth muscle
CS700728 5x 5 µm

Tissue FFPE Sections, Smooth muscle

Sign In for Pricing
View Details
Human UNK unkempt (UNK) activation kit by CRISPRa
GA113891 1 Kit

Human UNK unkempt (UNK) activation kit by CRISPRa

Sign In for Pricing
View Details
Histone H1 (Pan Nuclear Marker) (N/A), CF740 conjugate, 0.1mg/mL
BNC741816-500 1x 500 µL

Histone H1 (Pan Nuclear Marker) (N/A), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD137L / 4-1BBL / TNFSF9 (CD137L/1547), 1mg/mL
BNUM1547-50 1x 50 µL

CD137L / 4-1BBL / TNFSF9 (CD137L/1547), 1mg/mL

Sign In for Pricing
View Details