Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class gamma-14 (srg-14)

This Recombinant Serpentine receptor class gamma-14 (srg-14) spans the amino acid sequence from region 1-326.

Product Specifications

Product Name Alternative

Serpentine receptor class gamma-14, Protein srg-14

UniProt

P91275

Expression Region

1-326

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSDFSPDMKNLDIDPIPVDCDLSYNTNIEVLKFTAQIIYIITGIFLNSAVLGTILWRCRE VYSTNSFFTLFSVDCIANISILITEGLFARFFIYFTPICPVLADYFQSPLVGFKIIMLLT HHVSICKSLLQVLLVLNRMTCVLFPITHDSIWRKSLKYVISAVFLIPFCADWNIAISRVY MQSTYGGFWVSYFKKVSWASQSRFQLVFIIIALSFTFICTAITLLKLPERSKEIEKAISN ATVIISIGFTFKVLFQIYYSFFFSYTDASSPVYGFSFLALDFLTVGSPIVMICVSRNLRT HIFKSKRKNQTLSKMLTRTSGMVIAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 5AC (MUC5AC) (MUC5AC/917 + 45M1), CF488A conjugate, 0.1mg/mL
BNC881134-500 1x 500 µL

Mucin 5AC (MUC5AC) (MUC5AC/917 + 45M1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SIGLEC1 / CD169 / Sialoadhesin (HSn 7D2), CF640R conjugate, 0.1mg/mL
BNC402843-500 1x 500 µL

SIGLEC1 / CD169 / Sialoadhesin (HSn 7D2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS620270 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
2-Phenoxyethyl-2,2’-thenylaminoethane, Hydrochloride
TRC-P299450-1G 1 g

2-Phenoxyethyl-2,2’-thenylaminoethane, Hydrochloride

Sign In for Pricing
View Details
Mouse Nip7 activation kit by CRISPRa
GA206612 1 Kit

Mouse Nip7 activation kit by CRISPRa

Sign In for Pricing
View Details
Cotinine N-Beta-D-Glucuronide
TRC-C725175-5MG 5 mg

Cotinine N-Beta-D-Glucuronide

Sign In for Pricing
View Details