Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class alpha-12 (sra-12)

This Recombinant Serpentine receptor class alpha-12 (sra-12) spans the amino acid sequence from region 1-327.

Product Specifications

Product Name Alternative

Serpentine receptor class alpha-12, Protein sra-12

UniProt

Q20410

Expression Region

1-327

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGCASEIQAEIFTSFGQLFYASFQTILFLATIIGSLLAIFELCKKTTVPDSTRVLLIGSL FFANAHEFAYFTAPLKVFQLNIFNTNTSCYPLISTRDCIPTTTVLAMGISGNMLIQSALS IDRLLATIFPFSYSRMRALPGFVLLIMVLIPAMFTYSWIRLDIVLDDYQMFCSQWSANIS TRANTFLEICSYLTVAHIIINCLIILRNRAIEKRCRFDVTQRYLTSENLKTTQAICYLSI AQFLAMFMYSGGVLLMRKNRENIPTLIYFNVIVWVYAPPYACVSLAPLILFSLWNLKKQR HIQIKSVQSAQKETQDDYIRKLQKSWK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aldh18a1 Mouse Gene Knockout Kit (CRISPR)
KN501110 1 Kit

Aldh18a1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GFP Monoclonal Antibody
E-AB-48010-01 25 µL

GFP Monoclonal Antibody

Sign In for Pricing
View Details
GFP Monoclonal Antibody
E-AB-48010-02 100 µL

GFP Monoclonal Antibody

Sign In for Pricing
View Details
ALDH1B1 Antibody
8C14388-AAT 50 µg

ALDH1B1 Antibody

Sign In for Pricing
View Details
EnzyChrom™ α-Ketoglutarate Assay Kit
EAKG-100 100 Tests

EnzyChrom™ α-Ketoglutarate Assay Kit

Sign In for Pricing
View Details
TDP1 (NM_018319) Human Recombinant Protein
TP314927 20 µg

TDP1 (NM_018319) Human Recombinant Protein

Sign In for Pricing
View Details