Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class alpha-12 (sra-12)

This Recombinant Serpentine receptor class alpha-12 (sra-12) spans the amino acid sequence from region 1-327.

Product Specifications

Product Name Alternative

Serpentine receptor class alpha-12, Protein sra-12

UniProt

Q20410

Expression Region

1-327

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGCASEIQAEIFTSFGQLFYASFQTILFLATIIGSLLAIFELCKKTTVPDSTRVLLIGSL FFANAHEFAYFTAPLKVFQLNIFNTNTSCYPLISTRDCIPTTTVLAMGISGNMLIQSALS IDRLLATIFPFSYSRMRALPGFVLLIMVLIPAMFTYSWIRLDIVLDDYQMFCSQWSANIS TRANTFLEICSYLTVAHIIINCLIILRNRAIEKRCRFDVTQRYLTSENLKTTQAICYLSI AQFLAMFMYSGGVLLMRKNRENIPTLIYFNVIVWVYAPPYACVSLAPLILFSLWNLKKQR HIQIKSVQSAQKETQDDYIRKLQKSWK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Filaggrin (Keratinocyte Differentiation Marker) (FLG/1561), CF740 conjugate, 0.1mg/mL
BNC741561-500 1x 500 µL

Filaggrin (Keratinocyte Differentiation Marker) (FLG/1561), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TOMM40 (NM_001128917) Human Over-expression Lysate
LC427019 20 µg

TOMM40 (NM_001128917) Human Over-expression Lysate

Sign In for Pricing
View Details
Dehydroepiandrosterone 3beta-Glucuronide
TRC-D143175-1MG 1 mg

Dehydroepiandrosterone 3beta-Glucuronide

Sign In for Pricing
View Details
Galectin 3 Antibody
8C0203-AAT 50 µg

Galectin 3 Antibody

Sign In for Pricing
View Details
IL12B Antibody
KC-1570-01 50 μL

IL12B Antibody

Sign In for Pricing
View Details
IL12B Antibody
KC-1570-02 100 µL

IL12B Antibody

Sign In for Pricing
View Details