Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Taste receptor type 2 member 102 (Tas2r102)

This Recombinant Rat Taste receptor type 2 member 102 (Tas2r102) spans the amino acid sequence from region 1-327.

Product Specifications

Product Name Alternative

Taste receptor type 2 member 102, T2R102, Taste receptor type 2 member 37, T2R37

UniProt

Q675C0

Expression Region

1-327

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEPVIYSFATLLIHVEFIFGNLSNGFIVLSNFWDWVIKRKLSTIDKILLTLAISRITLIW EIYTWFTSVYGPSSFAIGMKLQILYFTWILSSHFSLWFATALSIFYLLRIANCSWKIFLY LKWRLKQVIVGMLLASLVFLPGILTQRTLEERPYRYGGNTSEDSMETDFARFTELILFNL TIFSVIPFSLASISFLLLIFSLWKHLRKMQLSSRGHGDPSTKAHTNALRIMVSFLLLYSI YFLSLLLSWIAQKHHSKLVDIIGIITGLMYPSAHSFILILGNSKLMQTSLWILSHLRCRL KGENILNPSGNQVTSCYIFCIANKSVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 5AC (MUC5AC) (58M1), CF647 conjugate, 0.1mg/mL
BNC471003-100 1x 100 µL

Mucin 5AC (MUC5AC) (58M1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Prostate Specific Antigen (PSA) (KLK3/2871R), CF405S conjugate, 0.1mg/mL
BNC042871-100 1x 100 µL

Prostate Specific Antigen (PSA) (KLK3/2871R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC16 / CA125 (Ovarian Carcinoma Marker) (MUC16/1860), CF405S conjugate, 0.1mg/mL
BNC041860-500 1x 500 µL

MUC16 / CA125 (Ovarian Carcinoma Marker) (MUC16/1860), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC2 (MLP/842), CF405S conjugate, 0.1mg/mL
BNC040842-100 1x 100 µL

MUC2 (MLP/842), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BCL10 (MALT-Lymphoma Marker) (151), CF488A conjugate, 0.1mg/mL
BNC881852-100 1x 100 µL

BCL10 (MALT-Lymphoma Marker) (151), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
VEGF (Vascular Endothelial Growth Factor) (VG76e), CF740 conjugate, 0.1mg/mL
BNC741687-100 1x 100 µL

VEGF (Vascular Endothelial Growth Factor) (VG76e), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details