Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 9G4 (OR9G4)

This Recombinant Human Olfactory receptor 9G4 (OR9G4) spans the amino acid sequence from region 1-327.

Product Specifications

Product Name Alternative

Olfactory receptor 9G4, Olfactory receptor OR11-216

UniProt

Q8NGQ1

Expression Region

1-327

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIFPSHDSQAFTSVDMEVGNCTILTEFILLGFSADSQWQPILFGVFLMLYLITLSGNMTL VILIRTDSHLHTPMYFFIGNLSFLDFWYTSVYTPKILASCVSEDKRISLAGCGAQLFFSC VVAYTECYLLAAMAYDRHAAICNPLLYSGTMSTALCTGLVAGSYIGGFLNAIAHTANTFR LHFCGKNIIDHFFCDAPPLVKMSCTNTRVYEKVLLGVVGFTVLSSILAILISYVNILLAI LRIHSASGRHKAFSTCASHLISVMLFYGSLLFMYSRPSSTYSLERDKVAALFYTVINPLL NPLIYSLRNKDIKEAFRKATQTIQPQT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human FAM150A Protein, Fc Tag
KMPH5184 20 µg

Human FAM150A Protein, Fc Tag

Sign In for Pricing
View Details
SLC12A1 Antibody
MBS9402557-01 0.1 mL

SLC12A1 Antibody

Sign In for Pricing
View Details
SLC12A1 Antibody
MBS9402557-02 5x 0.1 mL

SLC12A1 Antibody

Sign In for Pricing
View Details
PSIP1 (m) : 293T Lysate
sc-125539 100 µg - 200 µL

PSIP1 (m) : 293T Lysate

Sign In for Pricing
View Details
CDX4 (Caudal Type Homeobox 4) (MaxLight 750)
MBS6237636-01 0.1 mL

CDX4 (Caudal Type Homeobox 4) (MaxLight 750)

Sign In for Pricing
View Details
CDX4 (Caudal Type Homeobox 4) (MaxLight 750)
MBS6237636-02 5x 0.1 mL

CDX4 (Caudal Type Homeobox 4) (MaxLight 750)

Sign In for Pricing
View Details