Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 6A2 (OR6A2)

This Recombinant Human Olfactory receptor 6A2 (OR6A2) spans the amino acid sequence from region 1-327.

Product Specifications

Product Name Alternative

Olfactory receptor 6A2, Olfactory receptor 11-55, OR11-55, Olfactory receptor 6A1, Olfactory receptor OR11-83, hP2 olfactory receptor

UniProt

O95222

Expression Region

1-327

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEWRNHSGRVSEFVLLGFPAPAPLQVLLFALLLLAYVLVLTENTLIIMAIRNHSTLHKPM YFFLANMSFLEIWYVTVTIPKMLAGFVGSKQDHGQLISFEGCMTQLYFFLGLGCTECVLL AVMAYDRYMAICYPLHYPVIVSGRLCVQMAAGSWAGGFGISMVKVFLISGLSYCGPNIIN HFFCDVSPLLNLSCTDMSTAELTDFILAIFILLGPLSVTGASYVAITGAVMHIPSAAGRY KAFSTCASHLTVVIIFYAASIFIYARPKALSAFDTNKLVSVLYAVIVPLLNPIIYCLRNQ EVKRALCCTLHLYQHQDPDPKKASRNV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Anti-skeletal muscle antibody(ASMA) ELISA Kit
MBS2608829-01 48 Well

Bovine Anti-skeletal muscle antibody(ASMA) ELISA Kit

Sign In for Pricing
View Details
Bovine Anti-skeletal muscle antibody(ASMA) ELISA Kit
MBS2608829-02 96 Well

Bovine Anti-skeletal muscle antibody(ASMA) ELISA Kit

Sign In for Pricing
View Details
Bovine Anti-skeletal muscle antibody(ASMA) ELISA Kit
MBS2608829-03 5x 96 Well

Bovine Anti-skeletal muscle antibody(ASMA) ELISA Kit

Sign In for Pricing
View Details
Bovine Anti-skeletal muscle antibody(ASMA) ELISA Kit
MBS2608829-04 10x 96 Well

Bovine Anti-skeletal muscle antibody(ASMA) ELISA Kit

Sign In for Pricing
View Details
Horse vitamin D (VD) ELISA Kit
YP-W73245-01 48 Tests

Horse vitamin D (VD) ELISA Kit

Sign In for Pricing
View Details
Horse vitamin D (VD) ELISA Kit
YP-W73245-02 96 Tests

Horse vitamin D (VD) ELISA Kit

Sign In for Pricing
View Details