Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Olfactory receptor 226 (Olr226)

This Recombinant Rat Olfactory receptor 226 (Olr226) spans the amino acid sequence from region 1-327.

Product Specifications

Product Name Alternative

Olfactory receptor 226, Olfactory receptor-like protein I7

UniProt

P23270

Expression Region

1-327

Origin

Rattus norvegicus (Rat)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MERRNHSGRVSEFVLLGFPAPAPLRVLLFFLSLLAYVLVLTENMLIIIAIRNHPTLHKPM YFFLANMSFLEIWYVTVTIPKMLAGFIGSKENHGQLISFEACMTQLYFFLGLGCTECVLL AVMAYDRYVAICHPLHYPVIVSSRLCVQMAAGSWAGGFGISMVKVFLISRLSYCGPNTIN HFFCDVSPLLNLSCTDMSTAELTDFVLAIFILLGPLSVTGASYMAITGAVMRIPSAAGRH KAFSTCASHLTVVIIFYAASIFIYARPKALSAFDTNKLVSVLYAVIVPLFNPIIYCLRNQ DVKRALRRTLHLAQDQEANTNKGSKNG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FERD3L Human qPCR Primer Pair (NM_152898)
HP217986 200 Reactions

FERD3L Human qPCR Primer Pair (NM_152898)

Sign In for Pricing
View Details
LYRIC (MTDH) (NM_178812) Human Recombinant Protein
TP307238L 1 mg

LYRIC (MTDH) (NM_178812) Human Recombinant Protein

Sign In for Pricing
View Details
Cytochrome C (Mitochondrial Marker) (CYCS/3128R), CF488A conjugate, 0.1mg/mL
BNC883128-100 1x 100 µL

Cytochrome C (Mitochondrial Marker) (CYCS/3128R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Synaptotagmin 3 (SYT3) (NM_001160329) Human Over-expression Lysate
LY431997 100 µg

Synaptotagmin 3 (SYT3) (NM_001160329) Human Over-expression Lysate

Sign In for Pricing
View Details
FOXD4L6 Human Gene Knockout Kit (CRISPR)
KN421626 1 Kit

FOXD4L6 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
S100A16 Antibody
KC-43929-01 50 μL

S100A16 Antibody

Sign In for Pricing
View Details