Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse G-protein coupled receptor 55 (Gpr55)

This Recombinant Mouse G-protein coupled receptor 55 (Gpr55) spans the amino acid sequence from region 1-328.

Product Specifications

Product Name Alternative

G-protein coupled receptor 55

UniProt

Q3UJF0

Expression Region

1-328

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSQPERDNCSFDSVDKLTRTLQLAVHIPTFLLGLVLNLLAIRGFSAFLKKRKLDYIATSI YMINLAVFDLLLVLSLPFKMVLPQVESPLPSFCTLVECLYFISMYGSVFTICFISLDRFL AIQYPILASHLRSPRKTFGICCIIWMLVWIGSIPIYTFHREVERYKCFHNMSDVTWSASV FFPLEIFGFLLPMGIMGFCSYRSIHILLRRPDSTEDWVQQRDTKGLGTKREPCIWTIATN LVIFVVSFLPVHLGFFLQYLVRNRFILDCRMKQGISLFLQLSLCFSNINCCLDVFCYYFV IKEFRMRIKAHRPSTIKLVNQDTMVSRG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFI-35 shRNA Plasmid (h)
sc-93718-SH 20 µg

IFI-35 shRNA Plasmid (h)

Sign In for Pricing
View Details
Rat ZC3H12A siRNA
abx940247-01 15 nmol

Rat ZC3H12A siRNA

Sign In for Pricing
View Details
Rat ZC3H12A siRNA
abx940247-02 30 nmol

Rat ZC3H12A siRNA

Sign In for Pricing
View Details
ALOX15B Rabbit Polyclonal Antibody
orb578273 100 µL

ALOX15B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD137 Antibody
orb621008-01 50 μL

CD137 Antibody

Sign In for Pricing
View Details
CD137 Antibody
orb621008-02 100 µL

CD137 Antibody

Sign In for Pricing
View Details