Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Mas-related G-protein coupled receptor member B8 (Mrgprb8)

This Recombinant Rat Mas-related G-protein coupled receptor member B8 (Mrgprb8) spans the amino acid sequence from region 1-328.

Product Specifications

Product Name Alternative

Mas-related G-protein coupled receptor member B8

UniProt

Q7TN50

Expression Region

1-328

Origin

Rattus norvegicus (Rat)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDSSIPDPEADLIQLNGSYHTETSPCVIESRVMILLSIIIAFFGLAGNAMVLWLLAFRMR RNVFSVYILNLAGANFLFLCTHTAFSLEKIIVLFHSVHIHIPLLFYTLSTLAYLAGVSMV TAISAEYWLSGIWPYWYQGQRLKHTTTVICTGLWGLALLLSLLEGKSCGFLGSTYNQDVC WKLDFIIVAWLLVLFAVLSRSIQVLLVRIFCGSQRTPVTKLHVTIVLTALVLVICGFPFG IIFYLLYWTTEVYYIMPCNSFHETILLLSYINSCANPIICLLVGSIRHCRFQCGTLRLLL HRAMQDIPEEEGEELEEVVGERVQNSIP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD104 (UM-A9), CF640R conjugate, 0.1mg/mL
BNC400449-500 1x 500 µL

CD104 (UM-A9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF594 conjugate, 0.1mg/mL
BNC940034-500 1x 500 µL

Cytokeratin 8/18 (C-51), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF594 conjugate, 0.1mg/mL
BNC941231-500 1x 500 µL

Eosinophil Peroxidase (AHE-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF647 conjugate, 0.1mg/mL
BNC470008-100 1x 100 µL

MAGE A1 (MA454), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (B72.3), CF640R conjugate, 0.1mg/mL
BNC400276-500 1x 500 µL

TAG-72 / CA72.4 (B72.3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC18 / Mucin 18 / CD146 (OJ79c), CF568 conjugate, 0.1mg/mL
BNC680676-100 1x 100 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details