Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 5D16 (OR5D16)

This Recombinant Human Olfactory receptor 5D16 (OR5D16) spans the amino acid sequence from region 1-328.

Product Specifications

Product Name Alternative

Olfactory receptor 5D16, Olfactory receptor OR11-154

UniProt

Q8NGK9

Expression Region

1-328

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFLTERNTTSEATFTLLGFSDYLELQIPLFFVFLAVYGFSVVGNLGMIVIIKINPKLHTP MYFFLNHLSFVDFCYSSIIAPMMLVNLVVEDRTISFSGCLVQFFFFCTFVVTELILFAVM AYDHFVAICNPLLYTVAISQKLCAMLVVVLYAWGVACSLTLACSALKLSFHGFNTINHFF CELSSLISLSYPDSYLSQLLLFTVATFNEISTLLIILTSYAFIIVTTLKMPSASGHRKVF STCASHLTAITIFHGTILFLYCVPNSKNSRHTVKVASVFYTVVIPLLNPLIYSLRNKDVK DAIRKIINTKYFHIKHRHWYPFNFVIEQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

m-Tyramine Hydrochloride
TRC-T898505-250MG 250 mg

m-Tyramine Hydrochloride

Sign In for Pricing
View Details
2-Nitrothiophene (Technical Grade)
TRC-N565515-1G 1 g

2-Nitrothiophene (Technical Grade)

Sign In for Pricing
View Details
P21WAF1 (Tumor Suppressor Protein) (AC8), CF647 conjugate, 0.1mg/mL
BNC472378-100 1x 100 µL

P21WAF1 (Tumor Suppressor Protein) (AC8), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CYP11B1 (NM_001026213) Human Over-expression Lysate
LC422463 20 µg

CYP11B1 (NM_001026213) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Carcinoembryonic Antigen (CEA) ELISA Kit
RD-CEA-Mu-01 96 Tests

Mouse Carcinoembryonic Antigen (CEA) ELISA Kit

Sign In for Pricing
View Details
Mouse Carcinoembryonic Antigen (CEA) ELISA Kit
RD-CEA-Mu-02 48 Tests

Mouse Carcinoembryonic Antigen (CEA) ELISA Kit

Sign In for Pricing
View Details