Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabbit Adenosine receptor A1 (ADORA1)

This Recombinant Rabbit Adenosine receptor A1 (ADORA1) spans the amino acid sequence from region 1-328.

Product Specifications

Product Name Alternative

Adenosine receptor A1

UniProt

P34970

Expression Region

1-328

Origin

Oryctolagus cuniculus (Rabbit)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA LVIPLAILINIGPETYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKAVVT PRRAAVAIAGCWILSLVVGLTPMFGWNNLREVQRAWAANGSVGEPVIKCEFEKVISMEYM VYFNFFVWVLPPLLLMVLIYLEVFYLIRRQLSKKASASSGDPHKYYGKELKIAKSLALIL FLFALSWLPLHILNCVTLFCPSCQKPSILVYTAIFLTHGNSAMNPIVYAFRIHKFRVTFL KIWNDHFRCRPAPAGDGDEDLPEEKPND

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Ovary: left
CS700973 5x 5 µm

Tissue FFPE Sections, Ovary: left

Sign In for Pricing
View Details
DOG-1 (DG1/447 + DOG1.1), CF568 conjugate, 0.1mg/mL
BNC680726-500 1x 500 µL

DOG-1 (DG1/447 + DOG1.1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AFP (Alpha Fetoprotein) (C3), 0.2mg/mL
BNUB0354-500 1x 500 µL

AFP (Alpha Fetoprotein) (C3), 0.2mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF488A conjugate, 0.1mg/mL
BNC880391-500 1x 500 µL

CD81 / TAPA-1 (1.3.3.22), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8A (Cytotoxic- & Suppressor T-Cell Marker) (C8/1779R), CF640R conjugate, 0.1mg/mL
BNC401779-500 1x 500 µL

CD8A (Cytotoxic- & Suppressor T-Cell Marker) (C8/1779R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Total RNA, Endometrium
CR560456 5 µg

Tissue Total RNA, Endometrium

Sign In for Pricing
View Details