Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabbit Adenosine receptor A1 (ADORA1)

This Recombinant Rabbit Adenosine receptor A1 (ADORA1) spans the amino acid sequence from region 1-328.

Product Specifications

Product Name Alternative

Adenosine receptor A1

UniProt

P34970

Expression Region

1-328

Origin

Oryctolagus cuniculus (Rabbit)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA LVIPLAILINIGPETYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKAVVT PRRAAVAIAGCWILSLVVGLTPMFGWNNLREVQRAWAANGSVGEPVIKCEFEKVISMEYM VYFNFFVWVLPPLLLMVLIYLEVFYLIRRQLSKKASASSGDPHKYYGKELKIAKSLALIL FLFALSWLPLHILNCVTLFCPSCQKPSILVYTAIFLTHGNSAMNPIVYAFRIHKFRVTFL KIWNDHFRCRPAPAGDGDEDLPEEKPND

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 4 (KRT4) (KRT4/2804), CF740 conjugate, 0.1mg/mL
BNC742804-100 1x 100 µL

Cytokeratin 4 (KRT4) (KRT4/2804), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MIR520d Human qPCR Primer Pair (MI0003164)
HP300428 200 Reactions

MIR520d Human qPCR Primer Pair (MI0003164)

Sign In for Pricing
View Details
3,4'-Diacetyldiphenyl Oxide
TRC-D754250-500MG 500 mg

3,4'-Diacetyldiphenyl Oxide

Sign In for Pricing
View Details
Nkx2.2 Recombinant Rabbit Monoclonal Antibody [JE60-66]
HA722185 100 µL

Nkx2.2 Recombinant Rabbit Monoclonal Antibody [JE60-66]

Sign In for Pricing
View Details
Glycerol Triformate
TRC-G601545-5G 5 g

Glycerol Triformate

Sign In for Pricing
View Details
GLUT-1 (Tumor Progression and Mesothelioma Marker) (GLUT1/3132R), CF405S conjugate, 0.1mg/mL
BNC043132-500 1x 500 µL

GLUT-1 (Tumor Progression and Mesothelioma Marker) (GLUT1/3132R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details