Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sheep Gonadotropin-releasing hormone receptor (GNRHR)

This Recombinant Sheep Gonadotropin-releasing hormone receptor (GNRHR) spans the amino acid sequence from region 1-328.

Product Specifications

Product Name Alternative

Gonadotropin-releasing hormone receptor, GnRH receptor, GnRH-R

UniProt

P32237

Expression Region

1-328

Origin

Ovis aries (Sheep)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MANGDSPDQNENHCSAINSSILLTPGSLPTLTLSGKIRVTVTFFLFLLSTIFNTSFLLKL QNWTQRKEKRKKLSKMKVLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYL KLFSMYAPAFMMVVISLDRSLAITRPLAVKSNSKLGQFMIGLAWLLSSIFAGPQLYIFGM IHLADDSGQTEGFSQCVTHCSFPQWWHQAFYNFFTFSCLFIIPLLIMLICNAKIIFTLTR VLHQDPHKLQLNQSKNNIPQARLRTLKMTVAFATSFTVCWTPYYVLGIWYWFDPDMVNRV SDPVNHFFFLFAFLNPCFDPLIYGYFSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H1 (AE-4), CF647 conjugate, 0.1mg/mL
BNC470096-100 1x 100 µL

Histone H1 (AE-4), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF488A conjugate, 0.1mg/mL
BNC880745-100 1x 100 µL

CD45 / LCA (2B11 + PD7/26), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF405S conjugate, 0.1mg/mL
BNC040352-500 1x 500 µL

CD31 / PECAM-1 (158-2B3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF488A conjugate, 0.1mg/mL
BNC880305-500 1x 500 µL

CD95 (B-R18), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF568 conjugate, 0.1mg/mL
BNC681035-100 1x 100 µL

CD8 (C8/1035), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 14 (LL002), CF488A conjugate, 0.1mg/mL
BNC880499-500 1x 500 µL

Cytokeratin 14 (LL002), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details