Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bunopithecus hoolock Mas-related G-protein coupled receptor member X2 (MRGPRX2)

This Recombinant Bunopithecus hoolock Mas-related G-protein coupled receptor member X2 (MRGPRX2) spans the amino acid sequence from region 1-329.

Product Specifications

Product Name Alternative

Mas-related G-protein coupled receptor member X2

UniProt

Q4QXU6

Expression Region

1-329

Origin

Bunopithecus hoolock (Hoolock gibbon) (Hoolock hoolock)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPTTPAWGTESTTMDGNDQSLPLLCDKEALIPVFLILFIALVGLVGNGFVLWLLGFRMS RNAFSVYVLSLAGADFLFLCFQIINCLVYLRDFFCSISINFPSXFTTVMTCAYLAGLSML STISTERCLSVLWPIWYRCRRPRHLSAVVCVLLWALSLLLSILEGKFCGFLFSDGDFGWC QIFDFITAAWLIFLFVVLCASSLALLVRILCGSRGLPLTRLYLTILLTVLVFLLCGLPFG IQWFLILGFWNSDVLLCHIHLVSVVLSSLNSSANPIIYFFVGSFRKQWRLQQPILKLAFQ RALQDTAEVDHSEGCFPQGTSEMSRSSLV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NY-ESO-1 (CTAG1B) Mouse Monoclonal Antibody [Clone ID: UMAB72]
UM500060 100 µL

NY-ESO-1 (CTAG1B) Mouse Monoclonal Antibody [Clone ID: UMAB72]

Sign In for Pricing
View Details
AKR1B1 Polyclonal Antibody, RBITC Conjugated
bs-2405R-RBITC 100 µL

AKR1B1 Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details
Mouse Monoclonal TNF-alpha Antibody (J2D10) [Dylight 594]
NBP2-47677DL594 0.1 mL

Mouse Monoclonal TNF-alpha Antibody (J2D10) [Dylight 594]

Sign In for Pricing
View Details
Septin 3 (SEPT3) Mouse Monoclonal Antibody [Clone 2G3]
E45M20160V-2 50 µL

Septin 3 (SEPT3) Mouse Monoclonal Antibody [Clone 2G3]

Sign In for Pricing
View Details
RGD1311122 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV658022 1.0 µg DNA

RGD1311122 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
KCNK1 (NM_002245) Human Tagged Lenti ORF Clone
RC205321L4 10 µg

KCNK1 (NM_002245) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details