Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bunopithecus hoolock Mas-related G-protein coupled receptor member X2 (MRGPRX2)

This Recombinant Bunopithecus hoolock Mas-related G-protein coupled receptor member X2 (MRGPRX2) spans the amino acid sequence from region 1-329.

Product Specifications

Product Name Alternative

Mas-related G-protein coupled receptor member X2

UniProt

Q4QXU6

Expression Region

1-329

Origin

Bunopithecus hoolock (Hoolock gibbon) (Hoolock hoolock)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPTTPAWGTESTTMDGNDQSLPLLCDKEALIPVFLILFIALVGLVGNGFVLWLLGFRMS RNAFSVYVLSLAGADFLFLCFQIINCLVYLRDFFCSISINFPSXFTTVMTCAYLAGLSML STISTERCLSVLWPIWYRCRRPRHLSAVVCVLLWALSLLLSILEGKFCGFLFSDGDFGWC QIFDFITAAWLIFLFVVLCASSLALLVRILCGSRGLPLTRLYLTILLTVLVFLLCGLPFG IQWFLILGFWNSDVLLCHIHLVSVVLSSLNSSANPIIYFFVGSFRKQWRLQQPILKLAFQ RALQDTAEVDHSEGCFPQGTSEMSRSSLV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lynx1 (NM_011838) Mouse Untagged Clone
MC201945 10 µg

Lynx1 (NM_011838) Mouse Untagged Clone

Sign In for Pricing
View Details
Biuret 96% AR
00441 00100 100 g

Biuret 96% AR

Sign In for Pricing
View Details
Cyclin D2 (CCND2, G1/S-specific Cyclin-D2, KIAK0002, MGC102758) (APC)
125538-APC 100 µL

Cyclin D2 (CCND2, G1/S-specific Cyclin-D2, KIAK0002, MGC102758) (APC)

Sign In for Pricing
View Details
Lentiviral human FZD8 shRNA (UAS) - Lentiviral human FZD8 shRNA (UAS, iRFP) (100)
GTR15346794 1 Vial

Lentiviral human FZD8 shRNA (UAS) - Lentiviral human FZD8 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS813472 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
LANPL Rabbit Polyclonal Antibody (HRP)
orb468162 100 µL

LANPL Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details