Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Neuropeptides B/W receptor type 1 (Npbwr1)

This Recombinant Rat Neuropeptides B/W receptor type 1 (Npbwr1) spans the amino acid sequence from region 1-329.

Product Specifications

Product Name Alternative

Neuropeptides B/W receptor type 1, G-protein coupled receptor 7

UniProt

Q56UD9

Expression Region

1-329

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHNLSLFEPGRGNVSCGGPFLGCPNESNPAPLPLPQPLAVAVPVVYGVICAVGLAGNSAV LYVLLRTPRMKTVTNVFILNLAIADELFTLVLPINIADFLLRRWPFGEVMCKLIVAVDQY NTFSSLYFLAVMSADRYLVVLATAESRRVSGRTYGAARAVSLAVWALVTLVVLPFAVFAR LDEEQGRRQCVLVFPQPEAFWWRASRLYTLVLGFAIPVSTICALYITLLCRLRAIQLDSH AKALDRAKKRVTLLVVAILAVCLLCWTPYHLSTIVALTTDLPQTPLVIGISYFITSLSYA NSCLNPFLYAFLDDSFRRSLRQLVSCRTA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD53 (161-2), CF594 conjugate, 0.1mg/mL
BNC940324-100 1x 100 µL

CD53 (161-2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF594 conjugate, 0.1mg/mL
BNC940164-500 1x 500 µL

CD28 (204.12), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pmel17 / gp100 / SILV (NKI-beteb), CF740 conjugate, 0.1mg/mL
BNC740226-100 1x 100 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF770 conjugate, 0.1mg/mL
BNC700977-100 1x 100 µL

TGF-beta (1D11.16.8), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF568 conjugate, 0.1mg/mL
BNC680806-100 1x 100 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 18 (KRT18/835), CF740 conjugate, 0.1mg/mL
BNC740835-100 1x 100 µL

Cytokeratin 18 (KRT18/835), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details