Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 10J3 (OR10J3)

This Recombinant Human Olfactory receptor 10J3 (OR10J3) spans the amino acid sequence from region 1-329.

Product Specifications

Product Name Alternative

Olfactory receptor 10J3

UniProt

Q5JRS4

Expression Region

1-329

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPKLNSTFVTEFLFEGFSSFRRQHKLVFFVVFLTLYLLTLSGNVIIMTIIRLDHHLHTPM YFFLCMLSISETCYTVAIIPHMLSGLLNPHQPIATQSCATQLFFYLTFGINNCFLLTVMG YDRYVAICNPLRYSVIMGKRACIQLASGSLGIGLGMAIVQVTSVFGLPFCDAFVISHFFC DVRHLLKLACTDTTVNEIINFVVSVCVLVLPMGLVFISYVLIISTILKIASAEGQKKAFA TCASHLTVVIIHYGCASIIYLKPKSQSSLGQDRLISVTYTHHSPTEPCCVQPEEQGGQRC SAQSRGAKNSVSLMKRGCEGFSFAFINMY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSG5 (NM_002781) Human Over-expression Lysate
LY419109 100 µg

PSG5 (NM_002781) Human Over-expression Lysate

Sign In for Pricing
View Details
SH3KBP1 (NM_001024666) Human Over-expression Lysate
LY422529 100 µg

SH3KBP1 (NM_001024666) Human Over-expression Lysate

Sign In for Pricing
View Details
Human ERICH1 activation kit by CRISPRa
GA115929 1 Kit

Human ERICH1 activation kit by CRISPRa

Sign In for Pricing
View Details
Accuris qMAX Probe One-Step RT-qPCR Kit, No Rox, 500 reactions
PR2121-N-500 1 Each

Accuris qMAX Probe One-Step RT-qPCR Kit, No Rox, 500 reactions

Sign In for Pricing
View Details
SULt2a8 Mouse Gene Knockout Kit (CRISPR)
KN500295 1 Kit

SULt2a8 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
LINC00336 Human qPCR Primer Pair (NM_207497)
HP219787 200 Reactions

LINC00336 Human qPCR Primer Pair (NM_207497)

Sign In for Pricing
View Details