Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 10J3 (OR10J3)

This Recombinant Human Olfactory receptor 10J3 (OR10J3) spans the amino acid sequence from region 1-329.

Product Specifications

Product Name Alternative

Olfactory receptor 10J3

UniProt

Q5JRS4

Expression Region

1-329

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPKLNSTFVTEFLFEGFSSFRRQHKLVFFVVFLTLYLLTLSGNVIIMTIIRLDHHLHTPM YFFLCMLSISETCYTVAIIPHMLSGLLNPHQPIATQSCATQLFFYLTFGINNCFLLTVMG YDRYVAICNPLRYSVIMGKRACIQLASGSLGIGLGMAIVQVTSVFGLPFCDAFVISHFFC DVRHLLKLACTDTTVNEIINFVVSVCVLVLPMGLVFISYVLIISTILKIASAEGQKKAFA TCASHLTVVIIHYGCASIIYLKPKSQSSLGQDRLISVTYTHHSPTEPCCVQPEEQGGQRC SAQSRGAKNSVSLMKRGCEGFSFAFINMY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45RB (BRA-11G), CF405S conjugate, 0.1mg/mL
BNC040174-100 1x 100 µL

CD45RB (BRA-11G), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C-Myc (MYC275), CF488A conjugate, 0.1mg/mL
BNC880275-500 1x 500 µL

C-Myc (MYC275), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
D-Luciferin, FREE ACID
#10100 1x 10 mg

D-Luciferin, FREE ACID

Sign In for Pricing
View Details
Culture Tubes
T8305 1000 Units/Case

Culture Tubes

Sign In for Pricing
View Details
3-Amino-2,5-dichlorobenzoic Acid
TRC-A605273-5G 5 g

3-Amino-2,5-dichlorobenzoic Acid

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon: sigmoid
CS804867 5x 5 µm

Tissue FFPE Sections, Colon: sigmoid

Sign In for Pricing
View Details