Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat G-protein coupled receptor 3 (Gpr3)

This Recombinant Rat G-protein coupled receptor 3 (Gpr3) spans the amino acid sequence from region 1-329.

Product Specifications

Product Name Alternative

G-protein coupled receptor 3, G-protein-coupled receptor R4

UniProt

Q8K1Q3

Expression Region

1-329

Origin

Rattus norvegicus (Rat)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMWGAGRSMAWFSAGSGSVNVSIDPAEEPTGPATLLPSPRAWDVVLCISGTLVSCENALV VAIIVGTPAFRAPMFLLVGSLAVADLLAGLGLVLHFAADFCIGSPEMSLVLVGVLATAFT ASIGSLLAITVDRYLSLYNALTYYSETTVTRTYVMLALVWVGALGLGLVPVLAWNCRDGL TTCGVVYPLSKNHLVVLAIVFFMVFGIMLQLYAQICRIVCRHAQQIALQRHLLPASHYVA TRKGIATLAVVLGAFAACWLPFTVYCLLGDANSPPLYTYLTLLPATYNSMINPVIYAFRN QDVQKVLWAICCCCSTSKIPFRSRSPSDV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Seminal vesicle
CS701487 5x 5 µm

Tissue FFPE Sections, Seminal vesicle

Sign In for Pricing
View Details
Coenzyme A Trilithium Salt
TRC-C636400-10MG 10 mg

Coenzyme A Trilithium Salt

Sign In for Pricing
View Details
PRELID3A (NM_001142405) Human Over-expression Lysate
LY428072 100 µg

PRELID3A (NM_001142405) Human Over-expression Lysate

Sign In for Pricing
View Details
CD45RA (Leukocyte Marker) (K4B5), CF488A conjugate, 0.1mg/mL
BNC881680-500 1x 500 µL

CD45RA (Leukocyte Marker) (K4B5), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
XPD (ERCC2) (NM_000400) Human Over-expression Lysate
LY400141 100 µg

XPD (ERCC2) (NM_000400) Human Over-expression Lysate

Sign In for Pricing
View Details
Heptanoic Acid
TRC-H998455-250G 250 g

Heptanoic Acid

Sign In for Pricing
View Details