Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Vomeronasal type-1 receptor 42 (Vmn1r42)

This Recombinant Mouse Vomeronasal type-1 receptor 42 (Vmn1r42) spans the amino acid sequence from region 1-329.

Product Specifications

Product Name Alternative

Vomeronasal type-1 receptor 42, Vomeronasal type-1 receptor A1, Vomeronasal type-1 receptor A10, Vomeronasal type-1 receptor A3, Vomeronasal type-1 receptor A6

UniProt

Q8VBS7

Expression Region

1-329

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGDILFSSPQSMFSHTMNKNSILHTHSIIGKTFFSEIGIGISGNSFLLLVHILKFIRGHR PRLTDLPIGLLSLIHLLMLLVAAFIATDIFISRRGWDDIICKFLVYLYRVLRGFSLCTTS MLSILQAIILSPRSSCLAKFKHISPHHISGAILFLSVLYMLIGSQLLVSIIATPNLTMND FIYVTQSCSILPLSYLMQSIYSTLLAIREFFLISLMVLSNWYMVALLSMHRKQTQHLHGT NLSPKKSPEQSATQTILMLISFFLLMTIYDTIVSCSRTMFLNDPTSYSIELFIMHIYATV SPFVFMSTEKHIVNFLRSLGKRVINFNLH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD106 / VCAM1 (B-K9), CF740 conjugate, 0.1mg/mL
BNC740304-500 1x 500 µL

CD106 / VCAM1 (B-K9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF405M conjugate, 0.1mg/mL
BNC050322-100 1x 100 µL

CD3e (RIV9), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF647 conjugate, 0.1mg/mL
BNC470270-500 1x 500 µL

Fibronectin (HFN7.1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD59 (heavy chain of Protectin) (BRA-10G), CF647 conjugate, 0.1mg/mL
BNC470181-100 1x 100 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (CG106), CF405S conjugate, 0.1mg/mL
BNC042216-100 1x 100 µL

CD50 / ICAM3 (CG106), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (Membrane Metalloendopeptidase) (MME/1892), CF640R conjugate, 0.1mg/mL
BNC401892-500 1x 500 µL

CD10 (Membrane Metalloendopeptidase) (MME/1892), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details