Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Neuropeptides B/W receptor type 1 (Npbwr1)

This Recombinant Mouse Neuropeptides B/W receptor type 1 (Npbwr1) spans the amino acid sequence from region 1-329.

Product Specifications

Product Name Alternative

Neuropeptides B/W receptor type 1, G-protein coupled receptor 7

UniProt

P49681

Expression Region

1-329

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHNLTLFESGGDNVSCGGSSLGCPNGSSLAPLPLPQPLAVAVPVVYGVICAVGLAGNSAV LYVLLRTPRMKTVTNVFILNLAIADELFTLVLPINIADFLLRRWPFGEVMCKLIVAVDQY NTFSSLYFLAVMSADRYLVVLATAESRRVSGRTYGAARAVSLAVWALVTLVVLPFAVFAR LDEEQGRRQCVLVFPQPEAFWWRASRLYTLVLGFAIPVTTICALYTTLLCRLRAIQLDSH AKALDRAKKRVTLLVAAILAVCLLCWTPYHLSTIVALTTDLPQTPLVIGISYFITSLSYA NSCLNPFLYAFLDDSFRRSLRQLVSCRSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat NT-proBNP (N-Terminal Pro-Brain Natriuretic Peptide) ELISA Kit
E-EL-R3023-01 24 Tests

Rat NT-proBNP (N-Terminal Pro-Brain Natriuretic Peptide) ELISA Kit

Sign In for Pricing
View Details
Rat NT-proBNP (N-Terminal Pro-Brain Natriuretic Peptide) ELISA Kit
E-EL-R3023-02 48 Tests

Rat NT-proBNP (N-Terminal Pro-Brain Natriuretic Peptide) ELISA Kit

Sign In for Pricing
View Details
Rat NT-proBNP (N-Terminal Pro-Brain Natriuretic Peptide) ELISA Kit
E-EL-R3023-03 96 Tests

Rat NT-proBNP (N-Terminal Pro-Brain Natriuretic Peptide) ELISA Kit

Sign In for Pricing
View Details
CAP1 Human Knockdown Lysate
LY300082 100 µg

CAP1 Human Knockdown Lysate

Sign In for Pricing
View Details
Bcap29 Mouse Gene Knockout Kit (CRISPR)
KN502078 1 Kit

Bcap29 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS713198 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details