Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse CAAX prenyl protease 2 (Rce1)

This Recombinant Mouse CAAX prenyl protease 2 (Rce1) spans the amino acid sequence from region 1-329.

Product Specifications

Product Name Alternative

CAAX prenyl protease 2, EC= 3.4.22.-, Farnesylated proteins-converting enzyme 2, FACE-2, Prenyl protein-specific endoprotease 2, RCE1 homolog

UniProt

P57791

Expression Region

1-329

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAALGGDGLRLLSVSRPERQPESAALSGPGSGLCCWVSVFSCFSLACSYVGSLYVWKSEL PRDHPAVIKRRSTSVLVVSSLSPLCVLLWRELTGIQPGTSLLTLMGFRLEGIFPAALLPL LLTMILFLGPLMQLSMDCPCDLTDGLKVVLAPRSWARCLTDMRWLRNQVIAPLTEELVFR ACMLPMLAPCTGLGPAVFTCPLFFGVAHFHHIIEQLRFRQSSVGSIFVSAAFQFSYTAVF GAYTAFLFIRTGHLIGPVLCHSFCNYMGFPAVCAALEHPQKWPLLAGYALGVGLFLLLLQ PLTDPKLYGSLPLCMLLERTGASETLLCS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Alk sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
11771116 3x 1.0 µg

Alk sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Human LAG3 Protein, mFc Tag
orb3124008-01 10 µg

Human LAG3 Protein, mFc Tag

Sign In for Pricing
View Details
Human LAG3 Protein, mFc Tag
orb3124008-02 50 µg

Human LAG3 Protein, mFc Tag

Sign In for Pricing
View Details
Human LAG3 Protein, mFc Tag
orb3124008-03 100 µg

Human LAG3 Protein, mFc Tag

Sign In for Pricing
View Details
Human Anti-Human CLDN18.2 (Zolbetuximab) Monoclonal Antiboody, clone IMAB362 [Biosimilar]
CABT-Z512H 100 µg

Human Anti-Human CLDN18.2 (Zolbetuximab) Monoclonal Antiboody, clone IMAB362 [Biosimilar]

Sign In for Pricing
View Details
Alexa Fluor® 647 anti-GFP
GT11406 100 Tests

Alexa Fluor® 647 anti-GFP

Sign In for Pricing
View Details