Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class J-38 (srj-38)

This Recombinant Serpentine receptor class J-38 (srj-38) spans the amino acid sequence from region 1-330.

Product Specifications

Product Name Alternative

Serpentine receptor class J-38, Protein srj-38

UniProt

O16975

Expression Region

1-330

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLDDWIYIFLPRISCALAWVVNPIFVYFIFTEKSQTFGNYRYLLLFFALFNLLYSVVNVV VPIDIHNYRYCFFLILRHGWFVEISDFHYHMAAGRCSLVASSYALLLVHFIYRFLVIYDS SLTRLHFHWYMTGSLLLSVAYFVAWQTICWFLGYASVEMRQYVREEIRRTYGRDSMDFNM IGTLYDEASYEAKFKSWLATIIWSSISVASISAYMVLALLTIHKLKKMSCNASKKTSKFQ FELLRALIVQTLIPIVISFSPCLLCWYTPIFGIQLPREFNYFEVGALGLFSFVDPIAIIL CLPIFRHRISNFWKTSTTSLEEPSTKVRNI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Romo1 (NM_025946) Mouse Tagged ORF Clone
MG200128 10 µg

Romo1 (NM_025946) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
PDE9A (NM_001001578) Human Over-expression Lysate
LC424395 20 µg

PDE9A (NM_001001578) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Slc22a12 activation kit by CRISPRa
GA203948 1 Kit

Mouse Slc22a12 activation kit by CRISPRa

Sign In for Pricing
View Details
Mouse Neurog3 activation kit by CRISPRa
GA200313 1 Kit

Mouse Neurog3 activation kit by CRISPRa

Sign In for Pricing
View Details
3-Aminosalicylic Acid
TRC-A629260-500MG 500 mg

3-Aminosalicylic Acid

Sign In for Pricing
View Details
Recombinant ADAMTS13 Antibody
RC-15931-01 50 μL

Recombinant ADAMTS13 Antibody

Sign In for Pricing
View Details