Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class J-38 (srj-38)

This Recombinant Serpentine receptor class J-38 (srj-38) spans the amino acid sequence from region 1-330.

Product Specifications

Product Name Alternative

Serpentine receptor class J-38, Protein srj-38

UniProt

O16975

Expression Region

1-330

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLDDWIYIFLPRISCALAWVVNPIFVYFIFTEKSQTFGNYRYLLLFFALFNLLYSVVNVV VPIDIHNYRYCFFLILRHGWFVEISDFHYHMAAGRCSLVASSYALLLVHFIYRFLVIYDS SLTRLHFHWYMTGSLLLSVAYFVAWQTICWFLGYASVEMRQYVREEIRRTYGRDSMDFNM IGTLYDEASYEAKFKSWLATIIWSSISVASISAYMVLALLTIHKLKKMSCNASKKTSKFQ FELLRALIVQTLIPIVISFSPCLLCWYTPIFGIQLPREFNYFEVGALGLFSFVDPIAIIL CLPIFRHRISNFWKTSTTSLEEPSTKVRNI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCF4 (Transcription Factor 4) (TCF4/1705), CF594 conjugate, 0.1mg/mL
BNC941705-500 1x 500 µL

TCF4 (Transcription Factor 4) (TCF4/1705), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human N4BP2 activation kit by CRISPRa
GA110917 1 Kit

Human N4BP2 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Human SerpinE1/PAI-1 Protein (His Tag)
PDMH100362-01 20 µg

Recombinant Human SerpinE1/PAI-1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human SerpinE1/PAI-1 Protein (His Tag)
PDMH100362-02 100 µg

Recombinant Human SerpinE1/PAI-1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human SerpinE1/PAI-1 Protein (His Tag)
PDMH100362-03 500 µg

Recombinant Human SerpinE1/PAI-1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human SerpinE1/PAI-1 Protein (His Tag)
PDMH100362-04 1 mg

Recombinant Human SerpinE1/PAI-1 Protein (His Tag)

Sign In for Pricing
View Details