Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Trachypithecus francoisi Mas-related G-protein coupled receptor member X2 (MRGPRX2)

This Recombinant Trachypithecus francoisi Mas-related G-protein coupled receptor member X2 (MRGPRX2) spans the amino acid sequence from region 1-330.

Product Specifications

Product Name Alternative

Mas-related G-protein coupled receptor member X2

UniProt

Q4QXU4

Expression Region

1-330

Origin

Trachypithecus francoisi (Francois's leaf monkey) (Presbytis francoisi)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPTTLVWGTESTTMNGNDQALPLLCGKETLILVVLILFIALVGLVGNAFVLWLLGFRMR RNAFSVYVLSLAGADFLFLCFPMINCLAYLINFFHSISINFPSFFTTVMTCAYLAGLSML SAISTERCLSVLWPIWYRSRRPRHLSAVMCVLLWALSLLLSILEGKFCGFLFSDGDSGWC QTFDFITAAWLMFLFVVLCGSSLALLVRILCGSRGLPLTRLYLTILLTVLIFLLCGLPFG IQWFLILWIWKNSDVLFCHIHPVSVVLSSFNSSANPIIYFFVGSFRKQWRLRQPVLKLAL QRALQDTAEVDHSEGCFSQGTLEMSGSSLV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 8/18 (C-51), CF488A conjugate, 0.1mg/mL
BNC880034-100 1x 100 µL

Cytokeratin 8/18 (C-51), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF647 conjugate, 0.1mg/mL
BNC470322-500 1x 500 µL

CD3e (RIV9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (58M1), CF568 conjugate, 0.1mg/mL
BNC681003-500 1x 500 µL

Mucin 5AC (MUC5AC) (58M1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF640R conjugate, 0.1mg/mL
BNC400017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF594 conjugate, 0.1mg/mL
BNC940305-500 1x 500 µL

CD95 (B-R18), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF405S conjugate, 0.1mg/mL
BNC040861-500 1x 500 µL

HSP27 (G3.1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details