Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dictyostelium discoideum Cyclic AMP receptor-like protein E (crlE)

This Recombinant Dictyostelium discoideum Cyclic AMP receptor-like protein E (crlE) spans the amino acid sequence from region 1-330.

Product Specifications

Product Name Alternative

Cyclic AMP receptor-like protein E

UniProt

Q54LY7

Expression Region

1-330

Origin

Dictyostelium discoideum (Slime mold)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLSLSSYVLNLVGSILCLIGCLFIIGHFFWIPLLRTSLSRIIIYPTFILLLYDMVSFPSF ISKTADLYIERSTIICNFQEAIIQYLILSNFIWSVCISVNLLYLCFSPNKNLKKNELLYH LCSWGIPLIVVVITKIPNMISDNGNQCRFKSPNYIKFYLETILFIAFMLFNFIVAFITIK HIISGNLRESETTTTSVLFVNEKKITTKKIVWRLLLYPSILSICYIMTLVLSIYQFSTES YGSGGAYANSINNKRNDKNTESGNSNNNNNSYIEILLYISKAIFLLQGFFNALVYLRSSK LRDRYKKITIFRKIFWRDEADYQSINDGFN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 5AC (MUC5AC) (58M1), CF405S conjugate, 0.1mg/mL
BNC041003-500 1x 500 µL

Mucin 5AC (MUC5AC) (58M1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF640R conjugate, 0.1mg/mL
BNC400189-500 1x 500 µL

CD74 (BU45), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF740 conjugate, 0.1mg/mL
BNC740050-500 1x 500 µL

IgA Secretory Component (SC05), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF640R conjugate, 0.1mg/mL
BNC401231-100 1x 100 µL

Eosinophil Peroxidase (AHE-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF740 conjugate, 0.1mg/mL
BNC740008-500 1x 500 µL

MAGE A1 (MA454), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF555 conjugate, 0.1mg/mL
BNC550525-100 1x 100 µL

CD63 (MX-49.129.5), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details