Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Taste receptor type 2 member 136 (Tas2r136)

This Recombinant Rat Taste receptor type 2 member 136 (Tas2r136) spans the amino acid sequence from region 1-330.

Product Specifications

Product Name Alternative

Taste receptor type 2 member 136, T2R136, Taste receptor type 2 member 40, T2R40

UniProt

Q675B7

Expression Region

1-330

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKSQPVTQELHFIFPLFKTISSDIMSFLVSIAGIAMLAQIVLGTFANVFIVLVTCTDCIR RRKLFLADGILTSLAFCRIGMLWVILISWCSIVFHQALSLQVRFSICVGWAVTNHFNMWL ATILSILYLLKIGNFSNLIFLGLKRKIKSVFIVVLLASLVLLFPNLITVTVCETVQANGY RGNLTGKTKRTYFMNLTAMISFTLDNIISFTISMVCFLLLIYSLCKHLRTMRLYGKGPHN PSASAHIKALQAVISFLLLFSMFILSLIISGYNYMKPLNEPVHLICQLIGTLYPSSHSYV LLWGNRRIKLAFVLAMVQVRARLWLKEEKP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD95 (B-R18), CF640R conjugate, 0.1mg/mL
BNC400305-500 1x 500 µL

CD95 (B-R18), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF405S conjugate, 0.1mg/mL
BNC040003-500 1x 500 µL

CD45RO (UCHL-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF700 conjugate, 0.1mg/mL
BNC000437-500 1x 500 µL

CD47 (B6H12.2), CF700 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF640R conjugate, 0.1mg/mL
BNC400861-100 1x 100 µL

HSP27 (G3.1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF740 conjugate, 0.1mg/mL
BNC740745-100 1x 100 µL

CD45 / LCA (2B11 + PD7/26), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF594 conjugate, 0.1mg/mL
BNC940003-100 1x 100 µL

CD45RO (UCHL-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details