Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Mas-related G-protein coupled receptor member B8 (Mrgprb8)

This Recombinant Mouse Mas-related G-protein coupled receptor member B8 (Mrgprb8) spans the amino acid sequence from region 1-330.

Product Specifications

Product Name Alternative

Mas-related G-protein coupled receptor member B8

UniProt

Q7TN51

Expression Region

1-330

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDSSFPDWNIEFREQNESYFMESSSCDMSLAMSLLSIIIAIIGLTGNVIVLQLLGFHMHR NAFSVYIFNLSGANFLFLCTHIVFSLENLIRQFHYIDIHMALFSVNVTILAYLAGVSMIT AISVEYWLSVLWPTWYHAQRPKHTSTVICTLLWVFSLLLTLWNWIICKVLDYIYNWDMCW KLALIIVVWLLVLFVVLSRSNQALLFRVFCGSQQTPVTRLLVTIMLTALVVLICGFGIGI CFFYWKKEENSIMPCGYFYETILLLSGVNSCANPIICLFVGSIKHCQFQCGTLRLILQRA IQESPEEEDEEVEEVVEQEGGEEDEESTTL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF640R conjugate, 0.1mg/mL
BNC401073-500 1x 500 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF405S conjugate, 0.1mg/mL
BNC040164-100 1x 100 µL

CD28 (204.12), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF568 conjugate, 0.1mg/mL
BNC680050-100 1x 100 µL

IgA Secretory Component (SC05), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF647 conjugate, 0.1mg/mL
BNC470633-100 1x 100 µL

Von Willebrand Factor (3E2D10), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RA (PTPRC/1148), CF740 conjugate, 0.1mg/mL
BNC741148-100 1x 100 µL

CD45RA (PTPRC/1148), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 Tumor Suppressor Protein (PAb240), CF640R conjugate, 0.1mg/mL
BNC401634-500 1x 500 µL

P53 Tumor Suppressor Protein (PAb240), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details