Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 1094 (Olfr1094)

This Recombinant Mouse Olfactory receptor 1094 (Olfr1094) spans the amino acid sequence from region 1-330.

Product Specifications

Product Name Alternative

Olfactory receptor 1094, Olfactory receptor 179-7

UniProt

Q8VF13

Expression Region

1-330

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSIHSPGYTVRRIPVNNVTDTTMFILTGFTDDADLQVLLFLLFFVIYLFTLIGNLGLVLL VIGDSRLHNPMYYFLSVLSFLDACYSTVVTPKMLVNFISNDKSISYPGCVTEMFLFVTFG TTECFLLAAMAYDRFVAIYNPLLYAVKMSPRVYIPLIIACYSGGIMHATIHTVATFSLSF CASNEIRHVFCDIPPLLAISCSNTNINQLLLFYCVGSIEIITILIVLVSYSFILFAILKM NSAEGRRKIFSTCGSHLTGVSIYHGTILFMYVRPSSNYALEHDMIVSTFYTIVIPMLNPI IYSLRNKDVKEAMKKIFERNFFMNKVHFKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Methyl 2- (4-methylpyridin-2-yl) acetate
OR1056124 100 mg

Methyl 2- (4-methylpyridin-2-yl) acetate

Sign In for Pricing
View Details
Slc7a8 sgRNA CRISPR Lentivector (Rat) (Target 1)
K7602302 1.0 µg DNA

Slc7a8 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
PAPPA2 Protein Vector (Mouse) (pPM-C-His)
PV213457 500 ng

PAPPA2 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Sodium Sulfate Decahydrate
40000110-2 500 g

Sodium Sulfate Decahydrate

Sign In for Pricing
View Details
C10orf72 (VSTM4) Human qPCR Primer Pair (NM_001031746)
HP202946 200 Reactions

C10orf72 (VSTM4) Human qPCR Primer Pair (NM_001031746)

Sign In for Pricing
View Details
FolE Antibody
orb815436 2 mg

FolE Antibody

Sign In for Pricing
View Details