Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 495 (Olfr495)

This Recombinant Mouse Olfactory receptor 495 (Olfr495) spans the amino acid sequence from region 1-330.

Product Specifications

Product Name Alternative

Olfactory receptor 495, Olfactory receptor 204-37

UniProt

Q8VF12

Expression Region

1-330

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAFLEDGNHTIVTEFILLGLTDDPVLRDILFTIILCIYLVTVSGNLSTILLIRVSSQLHH PMYFFLSHLASVDIGISSSVTPNMLANFLVKPNTISYIGCSIQFTSAVFLATVECFLLAA MAYDRFVAICNPLLYSTKMSREACIQLVVGSYIQGLLNASFFTLSFFSLIFCGPNRINHF YCDLAPLVELSCSDVTLAVVITSISAGFITLTTVFVIAISYSCIFITIMKMHSTESRYKA FSTCTSHLTAVTLFYGTTMFIYVMPKSSYSTDQNKVLSVFYMVVIPMLNPLIYSLRNNEI KGALKRYLGKKIFSYGNLFCKTHYNDTHQV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC102A Antibody (C-term) Blocking peptide
MBS9218293-01 0.5 mg

CCDC102A Antibody (C-term) Blocking peptide

Sign In for Pricing
View Details
CCDC102A Antibody (C-term) Blocking peptide
MBS9218293-02 5x 0.5 mg

CCDC102A Antibody (C-term) Blocking peptide

Sign In for Pricing
View Details
N6AMT1 Protein Vector (Human) (pPM-C-HA)
PV027455 500 ng

N6AMT1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Pig mucin-5 subtype AC (MUC5AC) ELISA Kit
EK9076 48 Tests

Pig mucin-5 subtype AC (MUC5AC) ELISA Kit

Sign In for Pricing
View Details
Ethyl 5-amino-1-benzyl-1H-imidazole-4-carboxylate
sc-327495 500 mg

Ethyl 5-amino-1-benzyl-1H-imidazole-4-carboxylate

Sign In for Pricing
View Details
CBX1 Polyclonal Antibody
E-AB-67427-01 60 µL

CBX1 Polyclonal Antibody

Sign In for Pricing
View Details