Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 495 (Olfr495)

This Recombinant Mouse Olfactory receptor 495 (Olfr495) spans the amino acid sequence from region 1-330.

Product Specifications

Product Name Alternative

Olfactory receptor 495, Olfactory receptor 204-37

UniProt

Q8VF12

Expression Region

1-330

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAFLEDGNHTIVTEFILLGLTDDPVLRDILFTIILCIYLVTVSGNLSTILLIRVSSQLHH PMYFFLSHLASVDIGISSSVTPNMLANFLVKPNTISYIGCSIQFTSAVFLATVECFLLAA MAYDRFVAICNPLLYSTKMSREACIQLVVGSYIQGLLNASFFTLSFFSLIFCGPNRINHF YCDLAPLVELSCSDVTLAVVITSISAGFITLTTVFVIAISYSCIFITIMKMHSTESRYKA FSTCTSHLTAVTLFYGTTMFIYVMPKSSYSTDQNKVLSVFYMVVIPMLNPLIYSLRNNEI KGALKRYLGKKIFSYGNLFCKTHYNDTHQV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-GNAS Antibody (R3P27)
RHF56802 100 μg

Anti-GNAS Antibody (R3P27)

Sign In for Pricing
View Details
Rabbit anti-CDC7 Antibody, Affinity Purified
A302-504A 100 µg

Rabbit anti-CDC7 Antibody, Affinity Purified

Sign In for Pricing
View Details
CYTL1 shRNA Plasmid (m)
sc-142758-SH 20 µg

CYTL1 shRNA Plasmid (m)

Sign In for Pricing
View Details
Recombinant Campylobacter Jejuni argF Protein (aa 1-306) (strain RM1221)
VAng-Ly2520-50gEcoli 50 µg (E. coli)

Recombinant Campylobacter Jejuni argF Protein (aa 1-306) (strain RM1221)

Sign In for Pricing
View Details
Kcnq5 Mouse shRNA Plasmid (Locus ID 226922)
TR506756 1 Kit

Kcnq5 Mouse shRNA Plasmid (Locus ID 226922)

Sign In for Pricing
View Details
OAEC00299-50UG - cofilin1 Antibody (Phospho-Tyr139)
OAEC00299-50UG 50 µg

OAEC00299-50UG - cofilin1 Antibody (Phospho-Tyr139)

Sign In for Pricing
View Details