Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 495 (Olfr495)

This Recombinant Mouse Olfactory receptor 495 (Olfr495) spans the amino acid sequence from region 1-330.

Product Specifications

Product Name Alternative

Olfactory receptor 495, Olfactory receptor 204-37

UniProt

Q8VF12

Expression Region

1-330

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAFLEDGNHTIVTEFILLGLTDDPVLRDILFTIILCIYLVTVSGNLSTILLIRVSSQLHH PMYFFLSHLASVDIGISSSVTPNMLANFLVKPNTISYIGCSIQFTSAVFLATVECFLLAA MAYDRFVAICNPLLYSTKMSREACIQLVVGSYIQGLLNASFFTLSFFSLIFCGPNRINHF YCDLAPLVELSCSDVTLAVVITSISAGFITLTTVFVIAISYSCIFITIMKMHSTESRYKA FSTCTSHLTAVTLFYGTTMFIYVMPKSSYSTDQNKVLSVFYMVVIPMLNPLIYSLRNNEI KGALKRYLGKKIFSYGNLFCKTHYNDTHQV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VSTM5 Rabbit Polyclonal Antibody (FITC)
orb2086947 100 µL

VSTM5 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Mouse Sphingosine 1 Phosphate Receptor 1 (S1PR1) ELISA Kit
RD-S1PR1-Mu-48Tests 48 Tests

Mouse Sphingosine 1 Phosphate Receptor 1 (S1PR1) ELISA Kit

Sign In for Pricing
View Details
CLEC4A Protein, Human, Recombinant (His Tag)
PH51106M1-01 50 µg

CLEC4A Protein, Human, Recombinant (His Tag)

Sign In for Pricing
View Details
CLEC4A Protein, Human, Recombinant (His Tag)
PH51106M1-02 1 mg

CLEC4A Protein, Human, Recombinant (His Tag)

Sign In for Pricing
View Details
GLB1L2 Antibody Blocking peptide
orb1459865 500 µg

GLB1L2 Antibody Blocking peptide

Sign In for Pricing
View Details
MTX2, CT (MTX2, Metaxin-2, Mitochondrial outer membrane import complex protein 2) (AP)
MBS6322868-01 0.2 mL

MTX2, CT (MTX2, Metaxin-2, Mitochondrial outer membrane import complex protein 2) (AP)

Sign In for Pricing
View Details